gp2fasta

Science

Source (link to git-repo or to original if based on someone elses unmodified work): Add the source-code for this project on opencode.net

0
Score 50.0%
Description:

gp2fasta is QT application converting gp files from NCBI GenPept format to fasta. Its main purpose is to create fasta files with short, but still accurate headers for sequence.

For example:
>Strpur-115729834-h
PNQILMQFRLDDNGSSYYKELASIIYGASPEFELAIFTVCFKENPNALSTFTMAGGITQKVQTWDYNGGYIGSAYFSV

stands for:
gi: 115729834
organism: Strongylocentrotus purpuratus
additional information: h (hypothetical protein)
sequence:PNQILMQFRLDDNGSSYYKELASIIYGASPEFELAIFTVCFKENPNALSTFTMAGGITQKVQTWDYNGGYIGSAYFSV

Additionally, example input file was added.
Be the first to comment
12345678910
product-maker Base: 4 x 5.0 Ratings
File (click to download) Version Description PackagetypeArchitectureRelease Channel Downloads Date Filesize DL OCS-Install MD5SUM
*Needs pling-store or ocs-url to install things
Pling
0 Affiliates
Details
license
version
0.2
updated Aug 01 2007
added Jun 19 2007
downloads 24h
0
mediaviews 24h 0
pageviews 24h 0
System Tags app software